PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00166.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 384aa    MW: 43517.7 Da    PI: 9.7726
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00166.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.2e-55161421129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL+kkv + ++++ ++i evd +k+ePw+Lp ++k +ekewyfF+ rdkky+tg r+nrat++gyWkat
  Rsa1.0_00166.1_g00017.1  16 LPPGFRFHPTDEELITQYLHKKVLDISFSA-KAIGEVDFNKSEPWELPWMAKMGEKEWYFFCVRDKKYPTGLRTNRATEAGYWKAT 100
                              79**************************99.88***************8888899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +++lvg+kktLvfy+grapkg+kt+Wvmheyrle
  Rsa1.0_00166.1_g00017.1 101 GKDKEIYR-GKTLVGMKKTLVFYRGRAPKGQKTNWVMHEYRLE 142
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6312166IPR003441NAC domain
PROSITE profilePS5100559.02716166IPR003441NAC domain
PfamPF023652.8E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
METFCGFQKE EEQMDLPPGF RFHPTDEELI TQYLHKKVLD ISFSAKAIGE VDFNKSEPWE  60
LPWMAKMGEK EWYFFCVRDK KYPTGLRTNR ATEAGYWKAT GKDKEIYRGK TLVGMKKTLV  120
FYRGRAPKGQ KTNWVMHEYR LEGKLSPHNL PKTAKKEWVI CRVFQKTAGG KKIPISSLIR  180
IGSLGTGFNP SPLSHLTDDS SYNDKTKTEP VYVPCFSNQT DQLQGNTFNC FSSPVFNSTQ  240
ADIFHRLPLY QSSMLAQERS ALQAMIDNNT RQSLKAMSVS QETAVSTDMN DTSSDFEYAK  300
SLMSTDLLSS VMKESELRVR PNFLSRVRES RRRQPPSSST PVRPMAAGVG ISCSALVPHH  360
RLLVLLRYPS TSPSSVALAT TNLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-551317217174NAC domain-containing protein 19
3swm_B9e-551317217174NAC domain-containing protein 19
3swm_C9e-551317217174NAC domain-containing protein 19
3swm_D9e-551317217174NAC domain-containing protein 19
3swp_A9e-551317217174NAC domain-containing protein 19
3swp_B9e-551317217174NAC domain-containing protein 19
3swp_C9e-551317217174NAC domain-containing protein 19
3swp_D9e-551317217174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667450.0KC966745.1 Brassica napus NAC transcription factor 100 (NAC100.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013678255.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_013741166.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ20.0NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0A7BWT00.0A0A0A7BWT0_BRANA; NAC transcription factor 100
STRINGBra029313.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.10.0NAC domain containing protein 100